acetolactate synthase

Human ILVBL gene has 17 exons resides on chromosome 19 at q13.1.{{cite web | title = Entrez Gene:ILVBL ilvB (bacterial acetolactate synthase)-like| url = https://www.ncbi.nlm.nih.gov/gene/10994| access-date = }}

The catalytic peptide of ALS in Arabidopsis thaliana (mouse-eared cress) is a chloroplastic protein consisting of 670 residues, the last 615 of which form the active form. Three main domains are found, with two thiamine pyrophosphate sandwiching a DHS-like NAD/FAD-binding domain.{{cite web |title=Acetolactate synthase, chloroplastic (P17597) < InterPro < EMBL-EBI |url=https://www.ebi.ac.uk/interpro/protein/P17597}} In SCOP assignment, these subunits are named d1yhya1, d1yhya2, and d1yhya3 from the N-terminal to the C-terminal.{{cite web |title=SCOPe 2.07: Structural Classification of Proteins — extended |url=http://scop.berkeley.edu/pdb/code=1YHY}}

The structure of acetolactate synthase that was used for the picture on this page was determined using X-ray diffraction at 2.70 angstroms. X-ray diffraction uses X-rays at specified wavelengths to produce patterns, as the X–ray is scattered in certain ways that give an idea to the structure of the molecule being analyzed.

There are five specific ligands that interact with this protein. The five are listed below.

The FAD bound is not catalytic.

Acetolactate synthase is catalytic enzyme involved in the biosynthesis of various amino acids. This enzyme has the Enzyme Commission Code is 2.2.1.6, which means that the enzyme is a transketolase or a transaldolase, which is classified under the transferases that transfer aldehyde or ketone residues. In this case, acetolactate synthase is a transketolase, which moves back and forth, having both catabolic and anabolic forms. These act on a ketone (pyruvate) and can go back and forth in the metabolic chain. These are found in humans, animals, plants, and bacteria. In plants, they are located in the chloroplasts in order to help with the metabolic processes. In baker's yeast, they are located in the mitochondria.{{cite web |title=ILV2 - Acetolactate synthase catalytic subunit, mitochondrial precursor - Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) - ILV2 gene & protein |url=https://www.uniprot.org/uniprot/P07342 |website=www.uniprot.org}} In several experiments, it has been shown that mutated strains of Escherichia coli K-12 without the enzyme were not able to grow in the presence of only acetate or oleate as the only carbon sources.{{cite journal | vauthors = Dailey FE, Cronan JE | title = Acetohydroxy acid synthase I, a required enzyme for isoleucine and valine biosynthesis in Escherichia coli K-12 during growth on acetate as the sole carbon source | journal = Journal of Bacteriology | volume = 165 | issue = 2 | pages = 453–60 | date = February 1986 | pmid = 3511034 | pmc = 214440 | doi = 10.1128/jb.165.2.453-460.1986 }}

A catabolic version that does not bind FAD ({{InterPro|IPR012782}}) is found in some bacteria.

Acetolactate synthase, also known as acetohydroxy acid synthase, is an enzyme specifically involved in the conversion of pyruvate to acetolactate:

: 2 CH₃COCO₂⁻ → ⁻O₂CC(OH)(CH₃)COCH₃ + CO₂

The reaction uses thiamine pyrophosphate in order to link the two pyruvate molecules. The resulting product of this reaction, acetolactate, eventually becomes valine or leucine. A similar reaction of pyruvate with 2-oxobutanoate yields 2-aceto-2-hydroxy-butyrate, which is a precursor of isoleucine. All three of these amino acids are essential amino acids and cannot be synthesized by humans. This also leads to the systemic name pyruvate:pyruvate acetaldehydetransferase (decarboxylating).

Four specific residues are responsible for catalytic activity in this enzyme. They are listed here with cofactors required written after.

The primary sequence of this protein in Arabidopsis is listed below. Residues involved in catalytic activity are bolded.

Mutagenesis of Asp428, which is crucial carboxylate ligand to Mg(2+) in the "ThDP motif", leads to a decrease in the affinity of AHAS II for Mg(2+). While mutant D428N shows ThDP affinity close to that of the wild-type on saturation with Mg(2+), D428E has a decreased affinity for ThDP. These mutations also lead to dependence of the enzyme on K(+).{{cite journal | vauthors = Bar-Ilan A, Balan V, Tittmann K, Golbik R, Vyazmensky M, Hübner G, Barak Z, Chipman DM | title = Binding and activation of thiamin diphosphate in acetohydroxyacid synthase | journal = Biochemistry | volume = 40 | issue = 39 | pages = 11946–54 | date = October 2001 | pmid = 11570896 | doi = 10.1021/bi0104524 }}

{{hidden|Primary sequence.{{cite web |title=ALS - Acetolactate synthase, chloroplastic precursor - Arabidopsis thaliana (Mouse-ear cress) - ALS gene & protein |url=https://www.uniprot.org/uniprot/P17597 |website=www.uniprot.org}} Catalytic residues are bold|

>sp{{!}}P1759{{!}}86-667

TFISRFAPDQPRKGADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLADALLD

SVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPE

DSHLEQIVRLISESKKPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPXDDELSLHMLGMHGTVYANYAVEHSDLLLAFGVRFDDRVTGKLEAF

ASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGV

GQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAH

TFLGDPAQEDEIFPNMLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDVITEGDGR

}}

Because of inhibition and several factors it is a slow procedure.

In Arabidopsis, two chains of catalytic ALS ({{InterPro|IPR012846}}) is complexed with two regulatory small subunits ({{InterPro|IPR004789}}), [https://www.arabidopsis.org/locus?key=134242 AHASS2] and [https://www.arabidopsis.org/locus?name=AT2G31810 AHASS1].{{cite journal | vauthors = Chen H, Saksa K, Zhao F, Qiu J, Xiong L | title = Genetic analysis of pathway regulation for enhancing branched-chain amino acid biosynthesis in plants | journal = The Plant Journal | volume = 63 | issue = 4 | pages = 573–83 | date = August 2010 | pmid = 20497381 | doi = 10.1111/j.1365-313X.2010.04261.x }}{{cite journal | vauthors = Lee YT, Duggleby RG | title = Identification of the regulatory subunit of Arabidopsis thaliana acetohydroxyacid synthase and reconstitution with its catalytic subunit | journal = Biochemistry | volume = 40 | issue = 23 | pages = 6836–44 | date = June 2001 | pmid = 11389597 | doi=10.1021/bi002775q}}{{cite journal |last1=Mohammad Dezfulian, Curtis Foreman, Espanta Jalili, Mrinal Pal, Rajdeep K. Dhaliwal, Don Karl A. Roberto, Kathleen M. Imre, Susanne E. Kohalmi, and William L. Crosby. |title=Acetolactate synthase regulatory subunits play divergent and overlapping roles in branched-chain amino acid synthesis and Arabidopsis development. |journal=BMC Plant Biology |date=2017 |volume=17 |doi=10.1186/s12870-017-1022-6 |doi-access=free |pmid=28388946 |pmc=5384131 }} Such an arrangement is widespread in both bacterial and eukaryotic ALS. The hetromeric structure was demonstrated in E. coli in 1984 and in eukaryotes (S. cerevisiae and Porphyra purpurea) in 1997.{{cite journal | vauthors = Duggleby RG | title = Identification of an acetolactate synthase small subunit gene in two eukaryotes | journal = Gene | volume = 190 | issue = 2 | pages = 245–9 | date = May 1997 | pmid = 9197540 | doi=10.1016/s0378-1119(97)00002-4}} Most of the regulatory proteins have an ACT domain ({{InterPro|IPR002912}}) and some of them have a NiKR-like C-terminal ({{InterPro|IPR027271}})

In bacteria (E. coli)), Acetolactate synthase consists of three pairs of isoforms. Each pair includes a large subunit, which is thought to be responsible for catalysis, and a small subunit for feedback inhibition. Each subunit pair, or ALS I, II, and III respectively, is located on its own operon, ilvBN, ilvGM and ilvIH (where ilvN regulated ilvB, and vice versa). Together, these operons code for several enzymes involved in branched-chain amino acid biosynthesis. Regulation is different for each operon.{{cite journal | vauthors = Valle J, Da Re S, Schmid S, Skurnik D, D'Ari R, Ghigo JM | title = The amino acid valine is secreted in continuous-flow bacterial biofilms | journal = Journal of Bacteriology | volume = 190 | issue = 1 | pages = 264–74 | date = January 2008 | pmid = 17981982 | doi = 10.1128/JB.01405-07 | pmc = 2223729 }}

{{see also|Branched-chain amino acid#Synthesis}}

The ilvGMEDA operon encodes the ilvGM (ALS II) pair as well as a branched-chain-amino-acid transaminase (ilvE), dihydroxy-acid dehydratase (ilvD), and threonine ammonia-lyase (ilvA). It is regulated by feedback inhibition in the form of transcriptional attenuation. That is, transcription is reduced in the presence of the pathway's end-products, the branched-chain amino acids.

The ilvBNC operon encodes the ilvBN (ALS I) pair and a ketol-acid reductoisomerase (ilvC). It is similarly regulated, but is specific to isoleucine and leucine; valine does not affect it directly.

Both the ilvGMEDA and ilvBNC operons are derepressed during shortages of the branched-chain amino acids by the same mechanism that represses them. Both of these operons as well as the third, ilvIH, are regulated by leucine-responsive protein (Lrp).{{cite journal | vauthors = Calvo JM, Matthews RG | title = The leucine-responsive regulatory protein, a global regulator of metabolism in Escherichia coli | journal = Microbiological Reviews | volume = 58 | issue = 3 | pages = 466–90 | date = September 1994 | pmid = 7968922 | pmc = 372976 | doi = 10.1128/mmbr.58.3.466-490.1994 | doi-access = free }}{{cite book | vauthors = Pátek M | chapter = Branched-chain amino acids. | title = Amino Acid Biosynthesis: Pathways, Regulation and Metabolic Engineering | series = Microbiology Monographs | date = 2007 | volume = 5 | pages = 129–162 | publisher = Springer | location = Berlin, Heidelberg | doi = 10.1007/7171_2006_070 | isbn = 978-3-540-48596-4 }}

Inhibitors of ALS are used as herbicides that slowly starve affected plants of these amino acids, which eventually leads to inhibition of DNA synthesis. They affect grasses and dicots alike. They are not a chemistry class but rather a mechanism of action class with diverse chemistries. The ALS inhibitor family includes sulfonylureas (SUs), imidazolinones, triazolopyrimidines (see :Category:Triazolopyrimidines), pyrimidinyl oxybenzoates, and sulfonylamino carbonyl triazolinones.{{cite journal | vauthors = Zhou Q, Liu W, Zhang Y, Liu KK | title = Action mechanisms of acetolactate synthase-inhibiting herbicides | journal = Pesticide Biochemistry and Physiology | volume = 89 | issue = 2 | date = Oct 2007 | pages = 89–96 | doi = 10.1016/j.pestbp.2007.04.004 | bibcode = 2007PBioP..89...89Z }} {{As of|March 2022}}, the ALS inhibitors suffer the worst (known) resistance problem of all herbicide classes, having 169 known resistant target species.{{cite web | vauthors = Heap I | title=List of Herbicide Resistant Weeds by Herbicide Mode of Action | url=http://www.weedscience.org/Pages/MOA.aspx?MOAID=3 | language=en | access-date=2022-03-30 | publisher=HRAC (Herbicide Resistance Action Committee)}} The structures of ALS herbicides are radically different from the normal substrate and so none of them bind at the catalytic site but instead at a site specific to herbicidal action. Therefore resistance mutations are expected to have widely varying effects on normal ALS catalysis activity, positive, negative and neutral. Unsurprisingly that is exactly what experiments have shown, including Yu et al., 2007 finding resistance in Hordeum murinum due to a proline→serine substitution at amino acid 197 to increase ALS activity by 2x-3x.

CADASIL, an identified autosomal dominant condition characterized by the recurrence of subcortical infarcts leading to dementia, was previously mapped to “ILVBL” gene within a 2-cM interval, D19S226–D19S199. This gene encodes a protein highly similar to the acetolactate synthase of other organisms. No recombination event was observed with D19S841, a highly polymorphic microsatellite marker isolated from a cosmid mapped to this region. No mutation was detected on this gene in CADASIL patients, suggesting that it is not implicated in this disorder.

In the study of Escherichia coli, the FAD binding domain of ilvB has been shown to interact with ilvN and activate the AHAS I enzyme.{{cite journal | vauthors = Mitra A, Sarma SP | title = Escherichia coli ilvN interacts with the FAD binding domain of ilvB and activates the AHAS I enzyme | journal = Biochemistry | volume = 47 | issue = 6 | pages = 1518–31 | date = February 2008 | pmid = 18193896 | doi = 10.1021/bi701893b }}

{{Reflist}}

• {{MeshName|Acetolactate+synthase}}
• Ramachandran plot [https://web.archive.org/web/20121012144042/http://www.rcsb.org/pdb/images/1YHY_ram_m_500.pdf]
• [http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/CSA/CSA_Site_Wrapper.pl?pdb=1YHY]{{dead link|date=October 2016 |bot=InternetArchiveBot |fix-attempted=yes }}

{{Flavoproteins}}

{{Aldehyde-ketone transferases}}

{{Enzymes}}

{{Portal bar|Biology|border=no}}

Category:EC 2.2.1