crotamine

{{Infobox nonhuman protein

|image=Crotamin 1H5O.png|caption=The protein structure of crotamine ({{PDB|1H5O}})

|Symbol=CRO2

|UniProt=Q9PWF3

}}

Crotamine is a toxin present in the venom of the South American rattlesnake (Crotalus durissus terrificus). It is a 42-residue-long protein containing 11 basic residues (nine lysines, two arginines) and six cysteines. It has also been isolated from the venom of North American prairie rattlesnake, Crotalus viridis viridis. It was first isolated and purified by Brazilian scientist José Moura Gonçalves, and later intensively studied by his group of collaborators at the Medical School of Ribeirão Preto of the University of São Paulo.

Biological function

Crotamine has a number of biological actions: it acts on cell membrane's sodium channels, is slightly analgesic and is myotoxic, i.e., it penetrates the cells of muscles and promotes necrosis.{{cite journal | vauthors = Oliveira AL, Viegas MF, da Silva SL, Soares AM, Ramos MJ, Fernandes PA | title = The chemistry of snake venom and its medicinal potential | journal = Nature Reviews. Chemistry | volume = 6 | issue = 7 | pages = 451–469 | date = 2022-06-10 | pmid = 35702592 | pmc = 9185726 | doi = 10.1038/s41570-022-00393-7 }} Crotamine is homologous with other venom myotoxins and is similar to α-,β-defensins.

Biochemistry and mechanism

The amino acid sequence ({{mono|YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG}}, Cys4-Cys36, Cys11-Cys30, Cys18-Cys37) and the 3D molecular structure of crotamine have already been determined.

The protein structure of crotamine could not be initially determined through protein crystallization nor X-ray diffraction.{{cite journal | vauthors = Oguiura N, Boni-Mitake M, Rádis-Baptista G | title = New view on crotamine, a small basic polypeptide myotoxin from South American rattlesnake venom | journal = Toxicon | volume = 46 | issue = 4 | pages = 363–370 | date = September 2005 | pmid = 16115660 | doi = 10.1016/j.toxicon.2005.06.009 | bibcode = 2005Txcn...46..363O | s2cid = 40142037| url = http://www.repositorio.ufc.br/handle/riufc/59747 }} It was speculated that the difficulty was because crotamine has so many isoforms, leading to the formation of aggregates and different possible conformations of the protein. The structure and the shape of the protein was proposed through a 3D model generated by Siqueira et al. (2002) based on computational calculations that were supported with intensive molecular dynamics simulations and homology modeling procedures. Afterwards, Nicastro et al. (2003) discovered the structure of crotamine through nuclear magnetic resonance spectroscopy. Crotamine has a topology that was never before seen in active toxins that target ion channels; the protein is composed of a short N-terminal alpha helix, a type of protein formation, and a small antiparallel triple-stranded beta-sheet, another type of protein formation, arranged in an ab1b2b3 topology. Crotamine has similar structural fold conformations to the human β-defensin family as well as an identical arrangement of three disulfide bridges.

The gene and chromosome location responsible for its synthesis have been identified by the group led by Gandhi Rádis-Baptista, working at the Instituto Butantan, in São Paulo, Brazil. The mRNA has about 340 nucleotides and codifies a pre-crotamine, including the signal peptide, the mature crotamine, and a final lysine.

The Crotamine gene was the first gene to be mapped on a snake chromosome.

The gene responsible for coding the crotamine protein is labeled as Crt-p1 and its base pair sequence length is about 1.1kbp or 1100 bp.

It was reported that the crotamine gene was isolated twice from two different specimens, one in a method that resulted in a gene size of 1.8 kbp and in the other specimen a gene size of 1.1 kbp.{{cite journal | vauthors = Samejima Y, Aoki Y, Mebs D | title = Amino acid sequence of a myotoxin from venom of the eastern diamondback rattlesnake (Crotalus adamanteus) | journal = Toxicon | volume = 29 | issue = 4–5 | pages = 461–468 | date = 1991 | pmid = 1862521 | doi = 10.1016/0041-0101(91)90020-r | bibcode = 1991Txcn...29..461S }} The gene has been previously isolated in the C. durissus terrificus genome and the protein itself belongs to a group of small basic polypeptide myotoxins (SBPM). The contents of Crotalus venoms can vary according to subspecies and geographical location.{{cite journal | vauthors = Schenberg S | title = Geographical pattern of crotamine distribution in the same rattlesnake subspecies | journal = Science | volume = 129 | issue = 3359 | pages = 1361–1363 | date = May 1959 | pmid = 13658964 | doi = 10.1126/science.129.3359.1361 }} The Crt-p1 gene, as described by Radis-Bastista et al. 2003, consists of about three exons separated by one short phase-2 (140 bp) and one long phase-1 (900 bp) intron. Exon 1 codes for the first 19 amino acids of the signal peptide and includes the 5’-untranslated region. Exon 2 codes 39 amino acids to the mature crotamine and three signal peptide amino acids. Exon 3 codes for the terminal lysine and the last three amino acids of the mature toxin. Research on SBPM amino acid sequences among different Crotalus species has revealed a high degree of likeness ranging from 83% - 98%.

The amino acid code of proteins in the small basic polypeptide myotoxin family, which includes crotamine, have been sequenced. They were found to be similar with an average of 83% divergence. A crotamine amino acid sequence was compared to that of cloned DNA of myotoxin a, (the myotoxin used to model how SBPMs work). In the comparison, exon coding regions including the mature myotoxin and the signal peptide were 98% and 100% similar, respectively. The untranslated regions for 5’ and 3’ between the sample and the myotoxin a cDNA was 60% and 80%, respectively. When comparing the amino acid sequences of other proteins not in the SBPM family found in snake venoms, there is usually large divergence. When looking at the SBPM proteins, they have high similarity between different subspecies of the Crotalus genus and between different individuals of the same subspecies. This indicates, according to the Radis-Batista et al. 2003 study, that the crotamine gene and other SBPM genes have evolved recently.

References

{{Reflist}}

Further reading

{{refbegin|32em}}

  • {{cite journal | vauthors = Goncalves JM, Deutsch HF | title = Ultracentrifugal and zone electrophoresis studies of some crotalidae venoms | journal = Archives of Biochemistry and Biophysics | volume = 60 | issue = 2 | pages = 402–411 | date = February 1956 | pmid = 13292919 | doi = 10.1016/0003-9861(56)90444-1 }}
  • {{cite journal | vauthors = Giglio JR | title = Analytical studies on crotamine hydrochloride | journal = Analytical Biochemistry | volume = 69 | issue = 1 | pages = 207–221 | date = November 1975 | pmid = 2030 | doi = 10.1016/0003-2697(75)90581-3 }}
  • {{cite journal | vauthors = Laure CJ | title = [The primary structure of crotamine (author's transl)] | language = de | journal = Hoppe-Seyler's Zeitschrift für Physiologische Chemie | volume = 356 | issue = 2 | pages = 213–215 | date = February 1975 | pmid = 1176086 }}
  • {{cite journal | vauthors = De Lucca FL, Imaizumi MT, Haddad A | title = Characterization of ribonucleic acids from the venom glands of Crotalus durissus terrifucus (Ophidia, Reptilia) after manual extraction of the venom. Studies on template activity and base composition | journal = The Biochemical Journal | volume = 139 | issue = 1 | pages = 151–156 | date = April 1974 | pmid = 4463939 | pmc = 1166261 | doi = 10.1042/bj1390151 }}
  • {{cite journal | vauthors = Ownby CL, Cameron D, Tu AT | title = Isolation of myotoxic component from rattlesnake (Crotalus viridis viridis) venom. Electron microscopic analysis of muscle damage | journal = The American Journal of Pathology | volume = 85 | issue = 1 | pages = 149–166 | date = October 1976 | pmid = 970437 | pmc = 2032543 }}
  • {{cite journal | vauthors = Rádis-Baptista G, Oguiura N, Hayashi MA, Camargo ME, Grego KF, Oliveira EB, Yamane T | title = Nucleotide sequence of crotamine isoform precursors from a single South American rattlesnake (Crotalus durissus terrificus) | journal = Toxicon | volume = 37 | issue = 7 | pages = 973–984 | date = July 1999 | pmid = 10484745 | doi = 10.1016/s0041-0101(98)00226-8 | bibcode = 1999Txcn...37..973R | url = http://www.repositorio.ufc.br/handle/riufc/59788 | url-access = subscription }}
  • {{cite journal | vauthors = Kerkis A, Kerkis I, Rádis-Baptista G, Oliveira EB, Vianna-Morgante AM, Pereira LV, Yamane T | title = Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus | journal = FASEB Journal | volume = 18 | issue = 12 | pages = 1407–1409 | date = September 2004 | pmid = 15231729 | doi = 10.1096/fj.03-1459fje | doi-access = free | s2cid = 20510076 }}
  • {{cite journal | vauthors = Rádis-Baptista G, Kubo T, Oguiura N, Prieto da Silva AR, Hayashi MA, Oliveira EB, Yamane T | title = Identification of crotasin, a crotamine-related gene of Crotalus durissus terrificus | journal = Toxicon | volume = 43 | issue = 7 | pages = 751–759 | date = June 2004 | pmid = 15284009 | doi = 10.1016/j.toxicon.2004.02.023 | bibcode = 2004Txcn...43..751R | s2cid = 16350991 | url = http://www.repositorio.ufc.br/handle/riufc/59745 }}
  • {{cite journal | vauthors = Rádis-Baptista G, Kubo T, Oguiura N, Svartman M, Almeida TM, Batistic RF, Oliveira EB, Vianna-Morgante AM, Yamane T | display-authors = 6 | title = Structure and chromosomal localization of the gene for crotamine, a toxin from the South American rattlesnake, Crotalus durissus terrificus | journal = Toxicon | volume = 42 | issue = 7 | pages = 747–752 | date = December 2003 | pmid = 14757205 | doi = 10.1016/j.toxicon.2003.10.019 | bibcode = 2003Txcn...42..747R | url = http://www.repositorio.ufc.br/handle/riufc/59813 }}
  • {{cite journal | vauthors = Nicastro G, Franzoni L, de Chiara C, Mancin AC, Giglio JR, Spisni A | title = Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom | journal = European Journal of Biochemistry | volume = 270 | issue = 9 | pages = 1969–1979 | date = May 2003 | pmid = 12709056 | doi = 10.1046/j.1432-1033.2003.03563.x | s2cid = 20601072 | doi-access = free }}
  • {{cite journal | vauthors = Mouhat S, Jouirou B, Mosbah A, De Waard M, Sabatier JM | title = Diversity of folds in animal toxins acting on ion channels | journal = The Biochemical Journal | volume = 378 | issue = Pt 3 | pages = 717–726 | date = March 2004 | pmid = 14674883 | pmc = 1224033 | doi = 10.1042/BJ20031860 }}

{{refend}}