Alternative yeast nuclear code

{{Short description|An alternative genetic code found in the nuclear genome of some yeasts}}

The alternative yeast nuclear code (translation table 12) is a genetic code found in certain yeasts. However, other yeast, including Saccharomyces cerevisiae, Candida azyma, Candida diversa, Candida magnoliae, Candida rugopelliculosa, Yarrowia lipolytica, and Zygoascus hellenicus, definitely use the standard (nuclear) code.

The code

:   AAs = FFLLSSSSYY**CC*WLLLSPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

:Starts = -------------------M---------------M----------------------------

: Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).

Differences from the standard code

class="wikitable" style="border: none; text-align: center;"

|+

DNA codonsRNA codonsThis code (12)style="border: none; width: 1px;" |Standard code (1)
CTGCUGstyle="background-color:#b3dec0;" | Ser (S)style="border: none; width: 1px;" |style="background-color:#ffe75f;" | Leu (L)

Alternative initiation codons

Systematic range

See also

References

{{NLM content}}{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=19 March 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}

{{Reflist|refs=

{{Cite journal|journal=Nucleic Acids Res|date=25 August 1993|volume=21|issue=17|pages=4039–45|title=Non-universal decoding of the leucine codon CUG in several Candida species|author1=T. Ohama |author2=T. Suzuki |author3=M. Mori |author4=S. Osawa |author5=T. Ueda |author6=K. Watanabe |author7=T. Nakase |doi=10.1093/nar/21.17.4039 |pmid=8371978 |pmc=309997}}

{{Cite journal|journal=EMBO J|date=February 1993|volume=12|issue=2|pages=607–16|title=Non-standard translational events in Candida albicans mediated by an unusual seryl-tRNA with a 5'-CAG-3' (leucine) anticodon|author1=M. A. Santos |author2=G. Keith |author3=M. F. Tuite |doi=10.1002/j.1460-2075.1993.tb05693.x|pmid=8440250|pmc=413244}}

}}

{{Use dmy dates|date=August 2016}}

Category:Molecular genetics

Category:Gene expression

Category:Protein biosynthesis

{{Genetics-stub}}