Ascidian mitochondrial code

{{Short description|An alternative genetic code found in the mitochondrial genome of tunicates}}

The ascidian mitochondrial code (translation table 13) is a genetic code found in the mitochondria of Ascidia.

Code

:   AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSGGVVVVAAAADDEEGGGG

:Starts = ---M------------------------------MM---------------M------------

: Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

class="wikitable" style="border: none; text-align: center;"

|+

DNA codonsRNA codonsThis code (13)style="border: none; width: 1px;" |Standard code (1)
AGAAGAstyle="background-color:#ffe75f;" | Gly (G)style="border: none; width: 1px;" |style="background-color:#bbbfe0;" | Arg (R)
AGGAGGstyle="background-color:#ffe75f;" | Gly (G)style="border: none; width: 1px;" |style="background-color:#bbbfe0;" | Arg (R)
ATAAUAstyle="background-color:#ffe75f;" | Met (M)style="border: none; width: 1px;" |style="background-color:#ffe75f;" | Ile (I)
TGAUGAstyle="background-color:#ffe75f;" | Trp (W)style="border: none; width: 1px;" |style="background-color:#B0B0B0;" | STOP = Ter (*)

Systematic range and comments

There is evidence from a phylogenetically diverse sample of tunicates (Urochordata) that AGA and AGG code for glycine. In other organisms, AGA/AGG code for either arginine or serine and in vertebrate mitochondria they code a STOP. Evidence for glycine translation of AGA/AGG was first found in 1993 in Pyura stolonifera{{cite journal | vauthors = Durrheim GA, Corfield VA, Harley EH, Ricketts MH | title = Nucleotide sequence of cytochrome oxidase (subunit III) from the mitochondrion of the tunicate Pyura stolonifera: evidence that AGR encodes glycine | journal = Nucleic Acids Research | volume = 21 | issue = 15 | pages = 3587–8 | year = 1993 | pmid = 8393993 | pmc = 331473 | doi = 10.1093/nar/21.15.3587| url = https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?name=Halocynthia+roretzi }} and Halocynthia roretzi.{{cite journal | vauthors = Yokobori S, Ueda T, Watanabe K | title = Codons AGA and AGG are read as glycine in ascidian mitochondria | journal = Journal of Molecular Evolution | volume = 36 | issue = 1 | pages = 1–8 | date = January 1993 | pmid = 8381878 | doi = 10.1007/bf02407301 | bibcode = 1993JMolE..36....1Y | s2cid = 12603691 }} It was then confirmed by tRNA sequencing{{cite journal | vauthors = Kondow A, Suzuki T, Yokobori S, Ueda T, Watanabe K | title = An extra tRNAGly(U*CU) found in ascidian mitochondria responsible for decoding non-universal codons AGA/AGG as glycine | journal = Nucleic Acids Research | volume = 27 | issue = 12 | pages = 2554–9 | date = June 1999 | pmid = 10352185 | pmc = 148460 | doi = 10.1093/nar/27.12.2554 }} and sequencing whole mitochondrial genomes.{{cite journal | vauthors = Yokobori S, Ueda T, Feldmaier-Fuchs G, Pääbo S, Ueshima R, Kondow A, Nishikawa K, Watanabe K | title = Complete DNA sequence of the mitochondrial genome of the ascidian Halocynthia roretzi (Chordata, Urochordata) | journal = Genetics | volume = 153 | issue = 4 | pages = 1851–62 | date = December 1999 | doi = 10.1093/genetics/153.4.1851 | pmid = 10581290 | pmc = 1460873 | url = https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?name=Halocynthia+roretzi }}{{cite journal | vauthors = Yokobori S, Watanabe Y, Oshima T | title = Mitochondrial genome of Ciona savignyi (Urochordata, Ascidiacea, Enterogona): comparison of gene arrangement and tRNA genes with Halocynthia roretzi mitochondrial genome | journal = Journal of Molecular Evolution | volume = 57 | issue = 5 | pages = 574–87 | date = November 2003 | pmid = 14738316 | doi = 10.1007/s00239-003-2511-9 | bibcode = 2003JMolE..57..574Y | s2cid = 19474615 | url = https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?name=Ciona+savignyi }}

Alternative initiation codons

  • ATA, GTG and TTG
  • ATT is the start codon for the CytB gene in Halocynthia roretzi.{{cite journal | vauthors = Gissi C, Pesole G | title = Transcript mapping and genome annotation of ascidian mtDNA using EST data | journal = Genome Research | volume = 13 | issue = 9 | pages = 2203–12 | year = 2003 | pmid = 12915488 | pmc = 403730 | doi = 10.1101/gr.1227803 }}

See also

References

{{NLM content}}{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=5 June 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}

{{Reflist|33em}}

Category:Molecular genetics

Category:Gene expression

Category:Protein biosynthesis

{{Genetics-stub}}