Login
Login

Blepharisma nuclear code

{{Short description|An alternative genetic code found in the nuclear genome of some heterotrich ciliates}}

{{DISPLAYTITLE:Blepharisma nuclear code}}

The Blepharisma nuclear code (translation table 15) is a genetic code found in the nuclei of Blepharisma.{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 |archivedate=14 March 2016 |url-status=live }}

Code

:   AAs = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

:Starts = -----------------------------------M----------------------------

: Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

class="wikitable" style="border: none; text-align: center;"

|+

DNA codonsRNA codonsThis code (15)style="border: none; width: 1px;" |Standard code (1)
TAGUAGstyle="background-color:#b3dec0;" | Gln (Q)style="border: none; width: 1px;" |style="background-color:#B0B0B0;" | STOP = Ter (*)

Systematic range and comments

Ciliata: Blepharisma{{Cite journal|author=A Liang, K Heckman|date=1993|journal= Naturwissenschaften|volume=80|pages=225–226|title=Blepharisma uses UAA as a termination codon|issue=5|doi=10.1007/bf01175738|pmid=7685500|bibcode=1993NW.....80..225L|s2cid=6219316}}

See also

References

{{NLM content}}{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=3 July 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}

{{Reflist|refs=

}}

Category:Molecular genetics

Category:Gene expression

Category:Protein biosynthesis