Login
Login

Chlorophycean mitochondrial code

{{Short description|An alternative genetic code found in the mitochondrial genome of some green algae}}

The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.

Code

:   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

:Starts = -----------------------------------M----------------------------

: Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

class="wikitable" style="border: none; text-align: center;"

|+

DNA codonsRNA codonsThis code (16)style="border: none; width: 1px;" |Standard code (1)
{{mono|TAG}}{{mono|UAG}}style="background-color:#ffe75f;" | {{mono|Leu (L)}}style="border: none; width: 1px;" |style="background-color:#B0B0B0;" | {{mono|1=STOP = Ter (*)}}

Systematic range and comments

Chlorophyceae{{Cite journal|journal=Current Genetics|date=June 1996|volume=30|issue=1|pages=29–33|title=UAG is a sense codon in several chlorophycean mitochondria|author1=Y Hayashi-Ishimaru |author2=T Ohama |author3=Y Kawatsu |author4=K Nakamura |author5=S Osawa |pmid=8662206 |doi=10.1007/s002940050096|s2cid=7175211}} and the chytridiomycete fungus Spizellomyces punctatus.{{Cite journal|journal=Nucleic Acids Research|date=1 February 1997|volume=25|issue=3|pages=626–32|title=Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine|author1=M. J. Laforest |author2=I. Roewer |author3=B. F. Lang |pmid=9016605|pmc=146481 |doi=10.1093/nar/25.3.626}}

See also

References

{{NLM content}}{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=10 August 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}

{{Reflist|refs=

}}

{{Use dmy dates|date=August 2016}}

Category:Molecular genetics

Category:Gene expression

Category:Protein biosynthesis