Login
Login

Trematode mitochondrial code

{{Short description|An alternative genetic code found in the mitochondrial genome of trematodes}}

The trematode mitochondrial code (translation table 21) is a genetic code found in the mitochondria of Trematoda.

Code

:   AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNNKSSSSVVVVAAAADDEEGGGG

:Starts = -----------------------------------M---------------M------------

: Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

class="wikitable" style="border: none; text-align: center;"

|+

DNA codonsRNA codonsThis code (21)style="border: none; width: 1px;" |Standard code (1)
{{mono|TGA}}{{mono|UGA}}style="background-color:#ffe75f;" | {{mono|Trp (W)}}style="border: none; width: 1px;" |style="background-color:#B0B0B0;" | {{mono|1=STOP = Ter (*)}}
{{mono|ATA}}{{mono|AUA}}style="background-color:#ffe75f;" | {{mono|Met (M)}}style="border: none; width: 1px;" |style="background-color:#ffe75f;" | {{mono|Ile (I)}}
{{mono|AGA}}{{mono|AGA}}style="background-color:#b3dec0;" | {{mono|Ser (S)}}style="border: none; width: 1px;" |style="background-color:#bbbfe0;" | {{mono|Arg (R)}}
{{mono|AGG}}{{mono|AGG}}style="background-color:#b3dec0;" | {{mono|Ser (S)}}style="border: none; width: 1px;" |style="background-color:#bbbfe0;" | {{mono|Arg (R)}}
{{mono|AAA}}{{mono|AAA}}style="background-color:#bbbfe0;" | {{mono|Asn (N)}}style="border: none; width: 1px;" |style="background-color:#bbbfe0;" | {{mono|Lys (K)}}

Systematic range and comments

  • TrematodaEvolution of the mitochondrial genetic code. IV. AAA as an asparagine codon in some animal mitochondria. Ohama, T, S. Osawa, K. Watanabe, T.H. Jukes, 1990. J. Molec Evol. 30Platyhelminth mitochondrial DNA: evidence for early evolutionary origin of a tRNA(serAGN) that contains a dihydrouridine arm replacement loop, and of serine-specifying AGA and AGG codons Garey, J.R. and D.R. Wolstenholme, 1989. J. Molec. Evol. 28: 374-387 329-332.

See also

References

{{NLM content}}{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=11 August 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}

{{Reflist|refs=

}}

{{Use dmy dates|date=August 2016}}

Category:Molecular genetics

Category:Gene expression

Category:Protein biosynthesis

{{Genetics-stub}}